Hoeeeeeeeeeeee!!!!!

You're a Magical Girl!

You're sugar-hyped, caffeine-hyped, and permanently genki-er than a whole busload of Disney characters on crack. You eat too much, you're a total klutz, and somehow this makes you an ideal candidate for saving the world. If you're really unlucky, you get to get naked in an embarrassing transformation sequence in every single episode, with only a few sparkles and pastel blobs to cover your dignity. Which generic anime character are you?

Oh well ^_____^***

Loki and Heimdall played marriage @ 04:00 p.m.

Sunday, February 1, 2004
Random Sakamoto-centric post.
I finally decided to quit the DAY BREAK loop to check out the rare songs batch I downloaded yesterday (thanks to her *GLOMPS* ;_;).
I was not missing much tracks, but between the ones I didn't have, there's one called "Gathering Rain" from the Music Play Letter ~ Bring To Light CD.
I have no friggin' idea of who Watanabe Ken is or what is the rest of the CD about, but GODS, that SONG.
*eargasms*
Maaya-sama's sweet voice + piano = ;______________;
Geez, I love that woman ;_;

Loki and Heimdall played marriage @ 12:40 a.m.

Saturday, January 31, 2004
I have a new god and his name is Sakurai Takahiro.
*proceeds to worship*
It's funny, I was sure NOTHING could top NEO GENESIS in my Lokimeter and here comes kakusei!Loki with his silky sexy voice and shows me how wrong I can be.
Please, minna, do yourselves a favor and download DAY BREAK, I've been looping it for 3 hours approx. and I'm not tired yet *drowns in her own fluids*.
Oh oh, and Inu is one eBil person. We were rantin' on Loki and his sluttyness and she said she couldn't pair him up with Heim cuz both were kids and all that...
Long story short, now we're writing some sort of collab-thingy. Heim rapes Loki, Loki sulks, Heim realizes he likes Loki, Heim sulks, Loki goes sulk with Mayura... blahblah...
And I am writing the LokixMayura stuff...
...
*runs before she gets killed*
I DON'T LIKE IT!! I'M ONLY DOING IT TO TRY OUT STUFF, 'KAY?!

Loki and Heimdall played marriage @ 12:42 a.m.

Thursday, January 29, 2004
Oh. My. Dear. Fucking. God.
Kakusei!Loki and Narugami's Character CD's already OUT!!!! AND I CAN'T DOWNLOAD IT!!!!!
AAAAAAAAAAAAAHHHHHHHHHHH!!!!!!!!!! *runs around like a headless chicken*
Kakusei!Loki-sama didn't get to share single with Freya-ho!!!!
*COUGH*
I know I said I didn't hate her anymore.... and I don't, really, but I had to XDDDD.
AAAARRRGHHHHHH!!!!!! GIMME BACK MY ROOM NOW!!!!!!
*cries like a baby*

Loki and Heimdall played marriage @ 01:44 p.m.

Thursday, January 29, 2004
*cries*
I want my room back ;__;
I'm not changing it so drastically in so little time EVER AGAIN, I swear.
I want my mp3s and my anime downloads and my online life back to normal >__< *POUT*.
Luckily I've got some piccies of the before, so when it's done and I can take photos of the after you'll have both to compare :D.
And I know you don't care anyway, but blargh XP
*goes back to painting walls*

Loki and Heimdall played marriage @ 01:32 p.m.

Monday, January 26, 2004
Esta feliz historia comienza con una niña a la que le compran cama nueva y no hallan acomodo en su cuarto para ella.
Y claro, era sencillo mover los muebles, pero a la niña se le ocurrio la genial idea de arrancar el feo y viejo tapiz que había antes y ahora la niña no puede ni caminar por su habitación, no sabe si va a pintar las paredes, a saturarlas de posters o a rifarse a hacer alguna cosa abstracta y enferma... en el transcurso, corre el riesgo de morir de asma debido al polvo que emerge de todos lados.
Encontre un chingo de posters de DB, Ranma, y SM... y calendarios... O_o...
...
Y posters de las Spice Girls...
Y...
..........
Posters de los BSB >_____< *BURNS!!!!*
Ya estuvo q hoy no dormí en mi cuarto *dances XD*.

Loki and Heimdall played marriage @ 10:24 p.m.

Saturday, January 24, 2004
Heaven's Not Enough
Vocal: Steve Conte
Words: Tim Jensen
Music: Yoko Kanno

Heaven's not enough
If when you get there...
Just another blue
And heaven's not enough
You think you've found it
And it loses you

You've thought of all there is
But not enough
And it loses you in a cloud

"There" most everthing is nothin'
That it seems
"Where" you see the things you only wanna see

I'd fly away
To a higher plane
To say words I resist
To float away
To sigh
To breathe... forget

And heaven's not enough
If when I'm there I don't remember you
And heaven does enough
You think you know it
And it uses you

I saw so many things
But like a dream
Always losing me in a cloud

Cause I couldn't cry
Cause I turned away
Couldn't see the score
Didn't know the pain
Of leaving yesterday really far behind
In another life
In another dream
By a different name
Gave it all away
For a memory
And a quiet lie
And I felt the face
Of a cold tonight
Still don't know the score
But I know the pain
Of leaving everthing really far behind
And if I could cry
And if I could live what truth I did then take me there
Heaven good by

Friggin' song, how I love it... *angst waves all around* XDDDD
Naw, I think I'm already over my angsty-stage of the month/week/day/whatever... I shouldn't be depressed when there's so many people that I can trust and count on and viceversa... I kinda understand your feelings at times like this (and I'm gonna chew you for bashing the Marauders XD).
Wah, pretty song, kinda reminds me of "Blue"... *sigh* download it if you can people, it's Kanno, you know you won't regret it.

Loki and Heimdall played marriage @ 12:38 a.m.

Friday, January 23, 2004

My life is rated NC-17.
What is your life rated?

w00t!! *dances*
Ooohh!! And also Happy Belated B-day (for one day XD) to Paku Romi-sama~!!

Loki and Heimdall played marriage @ 10:57 p.m.

Friday, January 23, 2004
MINE!!!! <-- ((please note the crappy webcam shot))
At last ;___;!!!! *cries and updates the wishlist*.
I'm a happy lil puddle with DVDs, Neopets TCG deck and some other random crap that was bought today when we went downtown ^___^
And poo you fateback *is not even linking*, you've just fücked up my layouts >___< *packs things up and searches for a new server to move to*.
Nyah, this is gonna be one hell of a weekend. Tomorrow, the radio-thingy, and RP-chronicle for sunday... starting at 11:00 AM ^O^ *glomps da Tash* we're gonna break youuuu~
Natasha: Piss off *finger*, and DON'T call me that ¬¬x
I luv ya too girl ^^ *pets*.

Loki and Heimdall played marriage @ 10:38 p.m.

Thursday, January 22, 2004
Am I in blogging mood today or what?
Anyways, after much thought and listening to various songs, I've decided I forgive Porno Graffiti for "Melissa"... geez, I'm even starting to like the full version XD.
Yes, I'm trying to say I like them now.
But "Hitori No Yoru" still kicks the rest of their songs' asses.

Loki and Heimdall played marriage @ 11:35 p.m.

Thursday, January 22, 2004
Ocioooooo~

¿Cuál es tu chico ideal de anime?

¿Con qué animal te identificas?

Loki and Heimdall played marriage @ 10:56 p.m.

Thursday, January 22, 2004
Crap...
He estado soñando casi diario con gente de mi pasado... bueno, no tanto, están las locas del Sucre que sigo viendo, pero ya tengo rato sin salir con ellas (desde agosto, dammit...).
Y justo ahora se acabó de bajar, de pura casualidad "Come And Get Your Love", canción viejisisisisisíma de Real Mc Coy.
So what's the big deal, you ask?
Esa canción me recuerda HORRORES a Diana. Es una de tantas canciones a las que les metimos coreografía y similares en aquel entonces cuando teníamos como 10 añitos...
*sigh*
I miss her so much... damn >_< y lo peor es que nunca voy a tener el valor para llamarle y preguntarle qué ha sido de su vida todo este tiempo porque soy así de triste _ _...

I miss someone who used to be with me at any given chance...
I miss someone who called me everyday and spent hours talking about nothing in particular...
I miss someone who was always there to hug me and scold me whenever I did something wrong...
I miss someone who knew me almost better than myself...
I miss someone with whom I could talk without words...
I miss someone... and I don't even know who it is...

Este momento de paranoia, surrealismo e incoherencia fue traído a ustedes por cortesía de mi IE-sama, see ya'll next time XDDD!!

Loki and Heimdall played marriage @ 10:32 p.m.

Thursday, January 22, 2004
Ooh!! Forgot to mention!! Me's got Wolf's Rain OST 2 now ^___________^!!
Cloud 9!! Cloud 9!! FINALLY!! *bounces happily while looping*
Maaya-sama, Kanno-sama you'll always be my personal goddesses ;__;

Loki and Heimdall played marriage @ 04:44 p.m.

Thursday, January 22, 2004
AAAAAAHHHHHHH!!!!!!!!
Gimmegimmegimmegimmegimmegimmeeeeeee~!!!!! They're out on March 24, ALL of them at the same time!!!!!
(And in case you don't understand a single thing of what I'm squirming about, *points* those be character singles, with DVD extras: Yoh/Ren, Ryuu/Horohoro, Faust/Lyserg, Jeanne/Marco and Hao/Chocolove *cackles*).
This is gonna be so ON CRACK!!!! *can't wait*
Another addition to my b-day list: make Ame happy and give her those and/or Weiss' latest live ^_____^.

Loki and Heimdall played marriage @ 04:39 p.m.

Wednesday, January 21, 2004
AAAAAAAHHHHHH!!!!!!!!!!
OMGOMGOMGOMGOMG!!!!!!!!
;______________;!!!!!!!
*just saw Hagaren 15, is not even online, but's writing this anyway cause the impressions were damn too much*
You know the deal, rant ahead may be spoilerish, so don't read if you don't wanna know.

God, what a GOOD episode. Not good in fanservice and crack-level like 13, but as in plotwise and character development.
First, Roy.
Roy, dear and adored Colonel Roy Mustang, you are my god, allow me to worship you. Did you people saw that?! Huh?! He's not a friggin' heartless bastard as many of you think, man his personality and motivations are sooooo deep and amazing ;____; (and aside from that, he got that rain scene, kekekeke... *thinks* hey Rooooo~y <3 X3~~~ *goes stalk him*) <-- REALLY crappy pun there.
The thing about Winry's parents was just evil *stabs Arakawa-sensei*.
Ed and Al, I'm gonna glomp you to death. Specially you Al ;____;
THIS was Al's episode, really. I promise I won't make fun of Kugimiya Rie's squeaky voice anymore. Not after this episode. She was simply gorgeous in those last scenes.
And Paku Romi too, but she's always, so XP.
Oh yeah, Armstrong freaks me out.
And I've got eyecandy for you!!
Armstrong being all sparkly XD
Roy, being angsty as hell, feeding my plot-bunnies and making all the fangirls scream.
Roy 0 - Rain/Hawkeye 1
I think he's hot... that's just wrong, ne?
Al rules.
Wet!Taisa X3~~~
Hughes freeshot!!
Awwwwww ;_;

And now, I'm off to feed my Roybunnies and have an inner debate on my feelings for Envy, jya~!!

Loki and Heimdall played marriage @ 08:57 p.m.

Wednesday, January 21, 2004
And so, today I finally got my filthy little paws on Chrno Crusade's OP and ED singles ^___________^...
AND, also got Hagaren's new OP-ED (not the singles, but I can make-do with full versions for now).
And I started playing FFVIII again, kekekeke, LAGUNAAAAAAAAAAAAAAAAAA~!!!!!!
*is sick*

Loki and Heimdall played marriage @ 12:28 a.m.

Monday, January 19, 2004
Stolen from here. And made anime-only XD.

Who are your favorite characters?
Nagisa Kaworu, the King of All (NGE).
Son Gohan, cause I'm NEVER getting over him (DBZ).
Sakuma Ryuuichi, does it need ANY explanation? (Gravi).
Loki cause he's one of the newest additions (MaLoki).
Motomiya Daisuke, my one and only muse (Digimon 02).

Where did you first see this character? (ep, volume, place, doujinshi, etc.)
Kaworu - I'm pretty sure it was in a card... hell, from those old times when I still collected cards XD...
Gohan - 6th Grade, a classmates' pencil-case.
Ryuuichi - A screenshot from a Gravi site, it was him holding the almighty sketchbook ;_;
Loki - Hmm... debating between Hemuloki Scanlats or Hinoko's blog layout... not very sure...
Daisuke -  Er... some Digimon website? It was when 02 was starting to air in Japan, anyway.

What's your first impression?
Kaworu - OMG IS THIS A SHE OR A HE?!?!?!?! *backs away in fear*
Gohan - OMG GOKU HAS A SON AND THE SON HAS A TAIL!!!!
Ryuuichi - He likes crayons.. he's voiced by Yamaguchi Kappei... ;___;
Loki - Hey, cute lil shota victim!! X3
Daisuke - FASHION EMERGENCY!!

When did you know it was love?
Kaworu - I'm not very sure, but it came sometime after I started loving Rei... he had this dunnowhat and he was a mystery... (plus, red eyes and gray hair). I was intrigued and soon I had to find out about his tragic and brief existence ;_;
Gohan - The moment I saw him in the pencil-case *nods firmly* love at first sight.
Ryuuichi - I had my eyes on him from way before (y'know, Sleepless Beauty, NG, blahblah) but the moment I went all sparkly was during episode 2, when he starts singing Sleepless Beauty while heading towards the stage. It made me all fuzzy inside.
Loki - It was the damn opening sequence!! You DON'T put wings on such a pretty glompable shota!!
Daisuke - It's a mystery... I guess all the roleplay made me start loving him and then, when I noticed it was too late XD.

What's the coolest [canon] scene involving your favorite?
Kaworu - FULL FRIGGIN' EPISODE 24. Although beach-bed-finalwords get the super-special!mention.
Gohan - Uwahh... so many ;_;... all his training with Piccoro, WHOLE Cell-saga, when he's in his Great Saiyaman phase, Mystic Gohan *wipes drool*, and even when he's married and all... GYAAAHH, when Piccoro dies ;____; *sad fangirl, ignore please*.
Ryuuichi - Mmnnghh... *tries to pick ONLY one* well, yeah... when he's trying to make Shuuichi shine and draws all over the floor, episode 13.
Loki - Episode 25, all the "trip" with Hel... just WOW, I love you Loki-sama ;_;
Daisuke - When he kicks EVERYONE'S asses at the end of 02, getting them out of their sad-pathetic-little-fantasy-worlds. Eat that you Chosen Losers!! *cough!!* (That wasn't for you Ken-chan ^^).

What's your favorite thing about your favorite?
Kaworu - Looks, ideology, seiyuu. EVERYTHING.
Gohan - Probably the only saiyan with actual conscience and grey matter. I love how he's always sweet and caring and the moment someone messes with one of his loved beings he goes all berserk. I love you lil unstable saru ^^.
Ryuuichi - His personality. Definetely. He's not stupid, he's just playing with everyone X3.
Loki - He's so much like me in so many ways... plus, he's cute/hot (pick yours) and he's a slut XD.
Daisuke - Oh my sweetsweetsweet lil bundle o' angst ;_; *huggles him* no one ever realizes all he's worth 'cept for Ken and Wallace *gives the finger to the rest of 02!Chosen Losers*

So... 'ship your favorite with anyone in particular?
Kaworu - Shinji, obviously. And Rei, sick ole fetish o' mine ^^.
Gohan - Videl for the present Gohan. Mirai Trunks for Mirai Gohan (it's a shame he dies ;_;). Mirai #17 is also an option *drools*.
Ryuuichi - Tat-chan even if that's NEVER happening. And Shuuichi, one-sided thing, ya know? *sick*
Loki - HEIMDAAAA~RU!!!! LokixHeim/HeimxLoki all the way!! *nods firmly*. I kinda like LokixSpica too ^^;;
Daisuke - Daiken/Kensuke, Wallsuke/Dallace. 'Nuff said.

Loki and Heimdall played marriage @ 11:30 p.m.

Monday, January 19, 2004

Your Patronus is the Wolf! The wolf is a symbol of wisdom, loyalty and independence. He is one of history's more revered (and feared) characters.
That your Patronus is a wolf says that you are very wise as a person. You tend to be loyal to your friends, even when they screw up, but you are also independent. Finding that balance is key; finding it will ensure that you will be a wonderful witch or wizard!

What is Your Patronus? Version 1
brought to you by Quizilla

Yay, cool!! ;_;
There's where all my Metallium-Lupin inffluences come from X3
Girl, I NEED to talk to you, I have great news ^___^.

Loki and Heimdall played marriage @ 01:39 a.m.

Sunday, January 18, 2004
Nyah...
*ABAZA*
Gracias a todos ustedes que de una u otra manera siempre están ahí para hacerme sentir mejor y darme unas palabras de ánimo, en serio. No sé qué sería de mí sin todos ustedes.
Perdón a quien haya preocupado, ya toy mejor, estabilizándome pero ya más acá que allá (Mastercito, perdón que no haya estado, pero mejor, no iba a ir a tirarte mis desgracias cuando tu ya de por si andas traqueteado >_<).
Pero bueno, eso, gracias a todos *abazabazabazabazaaa~* perdón por mi crisis, nyah ;_;

Loki and Heimdall played marriage @ 03:05 p.m.

Saturday, January 17, 2004
...
Estoy hecha mierda... literalmente...
Me arden los ojos y los tengo hinchados de tanto llorar, traigo el ánimo por los suelos y estoy hecha mierda, eso.
¿Qué paso?
Anoche, por alguna razón conversando con mi abuela y mi madre a las 2:30 AM salio el tema de que kagami llegaba en dos semanas. Por alguna misteriosa y desconocida para todos razón, mi abuela pensó que faltaba más tiempo y entró en pánico. Histeria. No quiero profundizar porque ni ganas tengo, pero me pidieron que pospusiéramos todo... cuando yo, DOS DÍAS ANTES lo había hablado con ellas y no había habido el menor problema...
Cómo sea, snerk. En algún punto mi abuela NO SÉ POR QUÉ saltó a atacarme a mi, a decirme que ya era hora de que pusiera los pies en la tierra y dejara de soñar. Que ahora lo único que tenía que importarme era mi escuela, que era "la niña de las cuatro paredes", que mi madrina, mi tío, ella y medio mundo opinaban que yo debía estudiar una CARRERA EN SERIO y que de lo que quería hacer me iba a morir de hambre.
Para ese momento ya estaba yo llorando como idiota.
Me fui a pseudo-dormir a las 4 de la mañana, con el ánimo pisoteado y echa una desgracia.
Cosa curiosa, porque momentos antes mi mamá comentaba de cómo yo disfruto mi soledad...
Claro, qué más hubiera dado yo para poder tener alguien a quien abrazarme y llorarle a las 4 de la madrugada, je...
Seguí llorando hasta que me quedé dormida, pensando en cómo realmente debería mandar todo a la mierda y hacer lo que ellos quieren y dejarme de complicaciones. Tuve que mandarle un mensaje a Omar a las 8 de la mañana disculpándome porque no iba a ir... de hecho, ya ni planeaba ir...
Como a la 1, me despertó mi mamá, me dijo que había hablado con mi abuela y que las cosas respecto a lo de kagami se habían resuelto, que lo que les preocupaba era qué iba a ser de ella mientras yo tuviera clases, pero que si ella estaba consciente de que yo no iba a estar a esas horas, no había mayor problema.
Y mi abuela todavía va y se ríe de que tengo los ojos hinchados y me pide que sonría, ja.
Hablé con mi mamá, le dije que lo que me había lastimado más que nada, había sido el hecho de que mi abuela, toda la vida aparentó apoyarme con doblaje y de repente, de un momento a otro me enteró de que piensa que es un desperdicio de tiempo y que debería dejar de soñar.
Mi mamá me estuvo diciendo que hiciera como con los demás, que le diera el avión y que yo estudiara lo que quisiera, que ella no entendía...
Sin embargo, ahora mismo, me siento como parada en la nada. Con el ego y el ánimo pisoteados y horriblemente lastimada.
A veces me pregunto "¿Por qué me encanta complicarme tanto las cosas?" "¿Por qué no soy una adolescente normal que se va de antro todos los viernes y/o sábado, tiene un novio diferente cada tres meses, lleva un promedio de siete y planea estudiar Ingeniería en Sistemas?".
Quizá sería más fácil, ¿no? Para mi, para ellos, para todos... quizá realmente si dejara de soñar con cosas que sé que es muy poco probable que algún día alcanze y pusiera los pies en la tierra, sería diferente, sería más fácil y no dolería tanto, ¿no?
No sé, no recuerdo cuando fue la última vez que lloré tanto y ahora mismo ya ni pensar quiero...
*sigh*

Loki and Heimdall played marriage @ 05:13 p.m.

Saturday, January 17, 2004
So, I was supposed to write an angsty as hell entry... or a totally pointless one... BUT, after two hours of listening to a bunch of cool silly voice actors my angst decided to go to sleep before me.
^_______^ *huggles her emotional unstability*
A-NY-WAY~
Tomorrow's work-day... tomorrow's the first show we're actually recording... tomorrow my master won't be there ;___; *fretfretangstfret*.
...
And I'm gonna rant on Saiyuuki XD
Wish me luck cause I'm really going to need it >.<;;
See? There's my unstability again, gah X__x...

Loki and Heimdall played marriage @ 12:58 a.m.

Tuesday, January 13, 2004
I don't like to puke at all, but it'd be nice if one could vomit all those unpleasant feelings one has from time to time.
And I'm bringing this up cause right now I'm going through a "I hate/love my life"-stage.
And it's very disgusting. I'm all genki-hyper at one moment and the next I'm angsting non-stop.
Therefore, I've decided not to rant at all, at least, not for now.
Thanks XD *bows*.

Loki and Heimdall played marriage @ 09:36 p.m.

Sunday, January 11, 2004
Someone should put this in the dictionary, next to to the definition of:
hotevilsarcasticshinysparklingcynicflamingpieceofdamnsexybastard.
*worshipping the new OP-ED*

Loki and Heimdall played marriage @ 02:03 a.m.

Friday, January 9, 2004
Loki and Heimdall are back as promised and my emotional unstability as well.
Don't you hate it when you want to cry yet don't have enough guts to...?

Loki and Heimdall played marriage @ 11:23 p.m.